PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0013ss01170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 164aa    MW: 18710.1 Da    PI: 6.0112
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0013ss01170.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.3e-161461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+W+ eEd++l  +v+ +G  +W+  ++  g+ R++k+c++rw++yl
  Vang0013ss01170.1 14 KGAWSREEDDKLRAYVHTYGHSNWRQLPKFAGLARCGKSCRLRWLNYL 61
                       79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-22863IPR009057Homeodomain-like
PROSITE profilePS5129422.432965IPR017930Myb domain
SMARTSM007171.3E-121363IPR001005SANT/Myb domain
PfamPF002494.8E-151461IPR001005SANT/Myb domain
SuperFamilySSF466898.79E-231588IPR009057Homeodomain-like
CDDcd001672.83E-111661No hitNo description
PROSITE profilePS500904.49562106IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.606.3E-106495IPR009057Homeodomain-like
SMARTSM007176066107IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MVRTPFYDKN GVKKGAWSRE EDDKLRAYVH TYGHSNWRQL PKFAGLARCG KSCRLRWLNY  60
LRPNLKHGNY TPEEEEIIIR LHQQFGNSSL AISAETPEGD NYTLITGAEE DGVPPLLSYK  120
EFSGDFWSEP FLLEDTIHTF KDDICTGKGM ALLIPNFDAA YFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-131497789B-MYB
1h8a_C2e-13149727109MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150391e-126AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014523889.11e-75PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH41e-35MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLV7AG663e-65V7AG66_PHAVU; Uncharacterized protein
STRINGGLYMA06G45531.13e-53(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.16e-41myb domain protein 14